The Mother Board

Motherboards.org forums. Free tech support, motherboard ID, and more.
It is currently Wed Sep 26, 2018 1:46 am

All times are UTC - 8 hours




Post new topic Reply to topic  [ 27 posts ]  Go to page Previous  1, 2, 3  Next
Author Message
 Post subject:
PostPosted: Wed Nov 12, 2003 7:19 pm 
Offline
Enlightened Master
Enlightened Master

Joined: Wed Dec 11, 2002 2:29 pm
Posts: 14664
Location: Canada
do you have the client set for FAH or GAH?


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 7:25 pm 
Offline
Black Belt
Black Belt

Joined: Sat May 11, 2002 7:28 pm
Posts: 673
Location: Tacoma,WA
client is set to FAH


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 7:27 pm 
Offline
Enlightened Master
Enlightened Master

Joined: Wed Dec 11, 2002 2:29 pm
Posts: 14664
Location: Canada
then it's an uncharted one. rather interesting. Not even in the beta units...


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 7:40 pm 
Offline
Black Belt
Black Belt

Joined: Sat May 11, 2002 7:28 pm
Posts: 673
Location: Tacoma,WA
one thing i just thought of, when i installed the software, it began folding right away. i then went into configure, the client was set to no preference (default i assume) i then set it to FAH. think maybe i got a GAH wu?


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 7:42 pm 
Offline
Black Belt 3rd Degree
Black Belt 3rd Degree

Joined: Thu Nov 08, 2001 1:01 am
Posts: 3987
looks like a genome/ GAH wu. there will be a fahcore_ca.exe present if this is so. how many position protein is stated in fahlog.txt?


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 7:42 pm 
Offline
Enlightened Master
Enlightened Master

Joined: Wed Dec 11, 2002 2:29 pm
Posts: 14664
Location: Canada
it's rather possible.


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 7:55 pm 
Offline
Black Belt
Black Belt

Joined: Sat May 11, 2002 7:28 pm
Posts: 673
Location: Tacoma,WA
there is a fahcore_ca.exe. 146 positions in protein. sounds like GAH to me.... :( is this a bad thing?


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 7:57 pm 
Offline
Enlightened Master
Enlightened Master

Joined: Wed Dec 11, 2002 2:29 pm
Posts: 14664
Location: Canada
give us the full log file please.


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 7:57 pm 
Offline
Mobo-fu Master
Mobo-fu Master

Joined: Sun May 06, 2001 12:01 am
Posts: 37463
Location: Netherlands
fahcore = fah AFAIK, maybe a new clas as said earlier. when in doubt, email stanford.

_________________
We hate rut, but we fear change.
********************************
System error, strike any user to continue...


Top
 Profile  
Reply with quote  
 Post subject:
PostPosted: Wed Nov 12, 2003 8:01 pm 
Offline
Black Belt
Black Belt

Joined: Sat May 11, 2002 7:28 pm
Posts: 673
Location: Tacoma,WA
Here's the Full log:


--- Opening Log file [November 11 10:34:21]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[10:35:11] - Ask before connecting: No
[10:35:11] - User name: boheemee (Team 33258)
[10:35:11] - User ID not found locally
[10:35:11] + Requesting User ID from server
[10:35:11] - Machine ID: 1
[10:35:11]
[10:35:11] Work directory not found. Creating...
[10:35:11] Could not open work queue, generating new queue...
[10:35:12] Initialization complete
[10:35:12] + Benchmarking ...
[10:35:14] + Attempting to get work packet
[10:35:14] - Connecting to assignment server
[10:35:15] - Successful: assigned to (171.64.122.125).
[10:35:15] + News From Folding@Home: Welcome to Folding@Home
[10:35:15] Loaded queue successfully.
[10:35:15] - Deadline time not received.
[10:35:16] + Closed connections
[10:35:16]
[10:35:16] + Processing work unit
[10:35:16] Core required: FahCore_ca.exe
[10:35:16] Core not found.
[10:35:16] - Core is not present or corrupted.
[10:35:16] - Attempting to download new core...
[10:35:16] + Downloading new core: FahCore_ca.exe
[10:35:16] + 10240 bytes downloaded
[10:35:16] + 20480 bytes downloaded
[10:35:16] + 30720 bytes downloaded
[10:35:17] + 40960 bytes downloaded
[10:35:17] + 51200 bytes downloaded
[10:35:17] + 61440 bytes downloaded
[10:35:17] + 71680 bytes downloaded
[10:35:17] + 81920 bytes downloaded
[10:35:17] + 92160 bytes downloaded
[10:35:17] + 102400 bytes downloaded
[10:35:17] + 112640 bytes downloaded
[10:35:17] + 122880 bytes downloaded
[10:35:17] + 133120 bytes downloaded
[10:35:17] + 143360 bytes downloaded
[10:35:17] + 153600 bytes downloaded
[10:35:17] + 163840 bytes downloaded
[10:35:17] + 174080 bytes downloaded
[10:35:17] + 184320 bytes downloaded
[10:35:17] + 194560 bytes downloaded
[10:35:17] + 204800 bytes downloaded
[10:35:17] + 215040 bytes downloaded
[10:35:17] + 225280 bytes downloaded
[10:35:17] + 235520 bytes downloaded
[10:35:17] + 245760 bytes downloaded
[10:35:17] + 256000 bytes downloaded
[10:35:17] + 266240 bytes downloaded
[10:35:17] + 276480 bytes downloaded
[10:35:17] + 286720 bytes downloaded
[10:35:17] + 296960 bytes downloaded
[10:35:17] + 307200 bytes downloaded
[10:35:17] + 317440 bytes downloaded
[10:35:17] + 327680 bytes downloaded
[10:35:17] + 337920 bytes downloaded
[10:35:18] + 348160 bytes downloaded
[10:35:18] + 358400 bytes downloaded
[10:35:18] + 368640 bytes downloaded
[10:35:18] + 378880 bytes downloaded
[10:35:18] + 389120 bytes downloaded
[10:35:18] + 399360 bytes downloaded
[10:35:18] + 409600 bytes downloaded
[10:35:18] + 419840 bytes downloaded
[10:35:18] + 430080 bytes downloaded
[10:35:18] + 440320 bytes downloaded
[10:35:18] + 450560 bytes downloaded
[10:35:18] + 460800 bytes downloaded
[10:35:18] + 471040 bytes downloaded
[10:35:18] + 480026 bytes downloaded
[10:35:18] Verifying core Core_ca.fah...
[10:35:18] Signature is VALID
[10:35:18] Created: Wednesday April 10, 2002 00:01:22 UTC
[10:35:18] Signed: Monday March 3, 2003 00:18:15 UTC
[10:35:18]
[10:35:18] Trying to unzip core FahCore_ca.exe
[10:35:18] Decompressed FahCore_ca.exe (1466368 bytes) successfully
[10:35:18] + Core successfully engaged
[10:35:23]
[10:35:23] + Processing work unit
[10:35:23] Core required: FahCore_ca.exe
[10:35:23] Core found.
[10:35:23] Working on Unit 01 [November 11 10:35:23]
[10:35:23] + Working ...
[10:35:24] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[10:35:24]
[10:35:24] Proj: work/wudata_01
[10:35:24] Finding work files
[10:35:24] sizeof(CORE_PACKET_HDR) = 512
[10:35:24] Checking frame files
[10:35:24] - Couldn't open work/wudata_01.chk
[10:35:24] Starting from initial work packet
[10:35:24]
[10:35:24] Updating shared core-client information
[10:35:24] - Writing "work/wudata_01.key": (overwrite)successful.
[10:35:24] Key file to update shared file: work/wudata_01.key
[10:35:24] keyfile: 0 146 200 15 2 1 0
[10:35:24] Protein: Des2/pdb1ch4.33.spa
[10:35:24] - Frames Completed: 0, Remaining: 600
[10:35:24] - Dynamic steps required: 120000
[10:35:24]
[10:35:26] Printed current.prm
[10:35:26] Writing local files:
[10:35:26] - Writing "work/wudata_01.key": (overwrite)successful.
[10:35:26] - Writing "work/wudata_01.xyz": (overwrite)successful.
[10:35:26] - Writing "work/wudata_01.prm": (overwrite)successful.
[10:35:27] Starting design engine
[10:35:27] [SPG] project name: work/wudata_01.
[10:35:27] [SPG] 1 0
[10:35:27] [SPG] Initializing protein design engine
[10:35:27] [SPG] seed = 0
[10:35:27] [SPG] Initialization complete
[10:35:27] [SPG] Writing current.pdb, chainlength = 146
[10:35:27] [SPG] Writing current.xyz
[10:35:27] [SPG] Preprocessing . . .
[10:35:27] [SPG] 146 positions in protein


--- Opening Log file [November 11 10:38:48]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[10:38:48] - Ask before connecting: Yes
[10:38:48] - Use IE connection settings: Yes
[10:38:48] - User name: boheemee (Team 33258)
[10:38:48] - User ID = 4FE44F3853D9CFCF
[10:38:48] - Machine ID: 1
[10:38:48]
[10:38:48] Loaded queue successfully.
[10:38:48] Initialization complete
[10:38:48] + Benchmarking ...
[10:38:50]
[10:38:50] + Processing work unit
[10:38:50] Core required: FahCore_ca.exe
[10:38:50] Core found.
[10:38:50] Working on Unit 01 [November 11 10:38:50]
[10:38:50] + Working ...
[10:38:50] + Working...
[10:38:51] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[10:38:51]
[10:38:51] Proj: work/wudata_01
[10:38:51] Finding work files
[10:38:51] sizeof(CORE_PACKET_HDR) = 512
[10:38:51] Checking frame files
[10:38:51] - Couldn't open work/wudata_01.chk
[10:38:51] Starting from initial work packet
[10:38:51]
[10:38:51] Updating shared core-client information
[10:38:51] - Writing "work/wudata_01.key": (overwrite)successful.
[10:38:51] Key file to update shared file: work/wudata_01.key
[10:38:51] keyfile: 0 146 200 15 2 1 0
[10:38:51] Protein: Des2/pdb1ch4.33.spa
[10:38:51] - Frames Completed: 0, Remaining: 600
[10:38:51] - Dynamic steps required: 120000
[10:38:51]
[10:38:53] Printed current.prm
[10:38:53] Writing local files:
[10:38:53] - Writing "work/wudata_01.key": (overwrite)successful.
[10:38:53] - Writing "work/wudata_01.xyz": (overwrite)successful.
[10:38:54] - Writing "work/wudata_01.prm": (overwrite)successful.
[10:38:54] Starting design engine
[10:38:54] [SPG] project name: work/wudata_01.
[10:38:54] [SPG] 1 0
[10:38:54] [SPG] Initializing protein design engine
[10:38:54] [SPG] seed = 0
[10:38:54] [SPG] Initialization complete
[10:38:54] [SPG] Writing current.pdb, chainlength = 146
[10:38:54] [SPG] Writing current.xyz
[10:38:54] [SPG] Preprocessing . . .
[10:38:54] [SPG] 146 positions in protein
[10:41:38] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome D:\Program Files\MyFolding.html D:\Program Files\MyFolding.html
[10:43:02] Printing Queue Information
CURRENT QUEUE:
00 EMPTY
01 *ACTIVE " " (ca) 171.64.122.125:8080 November 11 10:35:16
02 EMPTY
03 EMPTY
04 EMPTY
05 EMPTY
06 EMPTY
07 EMPTY
08 EMPTY
09 EMPTY
[10:45:04] [SPG] Preprocessing complete
[10:45:04] Iterations: 0 of 600
[10:45:05] Finished
[10:45:05] [SPG] Native chi angles stored
[10:45:08] [SPG] Rotamers read
[10:45:08] [SPG] Starting genetic algorithm
[10:48:45] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/teampage?q=33258 http://folding.stanford.edu/cgi-bin/teampage?q=33258
[10:50:47] [SPG] seed: 12346620
[10:50:47] [SPG] Designing protein sequence 1 of 30
[10:56:14] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome D:\Program Files\MyFolding.html D:\Program Files\MyFolding.html
[11:05:50] [SPG] 10.0
[11:19:50] [SPG] 20.0
[11:33:51] [SPG] 30.0
[11:35:52] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/userpage?q=boheemee http://folding.stanford.edu/cgi-bin/userpage?q=boheemee


--- Opening Log file [November 11 11:40:18]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[11:40:19] - Ask before connecting: Yes
[11:40:19] - Use IE connection settings: Yes
[11:40:19] - User name: boheemee (Team 33258)
[11:40:19] - User ID = 4FE44F3853D9CFCF
[11:40:19] - Machine ID: 1
[11:40:19]
[11:40:20] Loaded queue successfully.
[11:40:20] Initialization complete
[11:40:20] + Benchmarking ...
[11:40:25]
[11:40:25] + Processing work unit
[11:40:25] Core required: FahCore_ca.exe
[11:40:25] Core found.
[11:40:26] Working on Unit 01 [November 11 11:40:26]
[11:40:26] + Working ...
[11:40:34] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[11:40:34]
[11:40:34] Proj: work/wudata_01
[11:40:34] Finding work files
[11:40:34] sizeof(CORE_PACKET_HDR) = 512
[11:40:34] Checking frame files
[11:40:36] Restarting from checkpointed files.
[11:40:36]
[11:40:36] Protein: Des2/pdb1ch4.33.spa
[11:40:36] - Frames Completed: 0, Remaining: 600
[11:40:36] - Dynamic steps required: 120000
[11:40:36]
[11:40:38] Printed current.prm
[11:40:38] Writing local files:
[11:40:38] - Writing "work/wudata_01.key": (overwrite)successful.
[11:40:38] - Writing "work/wudata_01.xyz": (overwrite)successful.
[11:40:39] - Writing "work/wudata_01.prm": (overwrite)successful.
[11:40:39] Starting design engine
[11:40:39] [SPG] project name: work/wudata_01.
[11:40:39] [SPG] 1 0
[11:40:39] [SPG] Initializing protein design engine
[11:40:39] [SPG] seed = 12346620
[11:40:39] [SPG] Initialization complete
[11:40:39] [SPG] Writing current.pdb, chainlength = 146
[11:40:39] [SPG] Writing current.xyz
[11:40:40] [SPG] Preprocessing . . .
[11:40:40] [SPG] 146 positions in protein
[11:47:07] [SPG] Preprocessing complete
[11:47:07] Iterations: 0 of 600
[11:47:08] Finished
[11:47:09] [SPG] Native chi angles stored
[11:47:12] [SPG] Rotamers read
[11:47:12] [SPG] Starting genetic algorithm
[11:53:05] [SPG] seed: 12346620
[11:53:05] [SPG] Designing protein sequence 1 of 30
[12:08:50] [SPG] 10.0
[12:24:34] [SPG] 20.0
[12:40:00] [SPG] 30.0
[12:55:01] [SPG] 40.0
[13:09:37] [SPG] 50.0
[13:18:38] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/userpage?q=boheemee http://folding.stanford.edu/cgi-bin/userpage?q=boheemee
[13:24:30] [SPG] 60.0
[13:40:50] [SPG] 70.0
[13:53:27] [SPG] 80.0
[14:05:40] [SPG] 90.0
[14:18:53] [SPG] 100.0
[14:18:53] [SPG] Writing current.xyz
[14:18:54] [SPG] Sequence 1 completed:
[14:18:54] ASMDSRKEEQFEKLISNLSMRDLGKASLALVLSERERMVTMYQSLGNLSD . . .
[14:18:55] Iterations: 20 of 600
[14:18:56] Finished
[14:18:58] [SPG] seed: 24693240
[14:18:58] [SPG] Designing protein sequence 2 of 30
[14:34:05] [SPG] 10.0
[14:48:52] [SPG] 20.0
[15:03:19] [SPG] 30.0
[15:17:10] [SPG] 40.0
[15:30:55] [SPG] 50.0
[15:44:51] [SPG] 60.0
[15:58:44] [SPG] 70.0
[16:12:01] [SPG] 80.0
[16:24:53] [SPG] 90.0
[16:37:23] [SPG] 100.0
[16:37:23] [SPG] Writing current.xyz
[16:37:24] [SPG] Sequence 2 completed:
[16:37:24] SQFKSAQSTLTMEFMAKLKLPQVGKEVLALIITNVETAARYVTAYGQMAE . . .
[16:37:25] Iterations: 40 of 600
[16:37:26] Finished
[16:37:28] [SPG] seed: 37039860
[16:37:28] [SPG] Designing protein sequence 3 of 30
[16:52:33] [SPG] 10.0
[17:06:56] [SPG] 20.0
[17:20:51] [SPG] 30.0
[17:34:32] [SPG] 40.0
[17:40:21] + Working...
[17:48:06] [SPG] 50.0
[18:01:44] [SPG] 60.0
[18:14:58] [SPG] 70.0
[18:28:11] [SPG] 80.0
[18:41:14] [SPG] 90.0
[18:54:10] [SPG] 100.0
[18:54:10] [SPG] Writing current.xyz
[18:54:11] [SPG] Sequence 3 completed:
[18:54:11] SELTEVEKKQVRELLRQLASEPIGLKALAELLIDIEDMQEYYVEWGNLTR . . .
[18:54:12] Iterations: 60 of 600
[18:54:13] Finished
[18:54:15] [SPG] seed: 49386480
[18:54:15] [SPG] Designing protein sequence 4 of 30
[19:09:17] [SPG] 10.0
[19:23:31] [SPG] 20.0
[19:37:31] [SPG] 30.0
[19:51:07] [SPG] 40.0
[20:04:50] [SPG] 50.0
[20:18:20] [SPG] 60.0
[20:31:57] [SPG] 70.0
[20:45:06] [SPG] 80.0
[20:58:16] [SPG] 90.0
[21:11:01] [SPG] 100.0
[21:11:01] [SPG] Writing current.xyz
[21:11:02] [SPG] Sequence 4 completed:
[21:11:02] SSHQERQNRKVEQLKSEAKYDEIGKEALAKLLTTKEEMKQWMTKJGEINQ . . .
[21:11:03] Iterations: 80 of 600
[21:11:04] Finished
[21:11:06] [SPG] seed: 61733100
[21:11:06] [SPG] Designing protein sequence 5 of 30
[21:26:08] [SPG] 10.0
[21:40:38] [SPG] 20.0
[21:55:28] [SPG] 30.0
[22:09:35] [SPG] 40.0
[22:22:38] [SPG] 50.0
[22:36:14] [SPG] 60.0
[22:48:59] [SPG] 70.0
[23:01:52] [SPG] 80.0
[23:14:15] [SPG] 90.0
[23:26:38] [SPG] 100.0
[23:26:38] [SPG] Writing current.xyz
[23:26:38] [SPG] Sequence 5 completed:
[23:26:38] IALDENKKEKIRDMIRSVVTNTIGRKAFALVIRKVPSTMQYYREYGRLRS . . .
[23:26:39] Iterations: 100 of 600
[23:26:40] Finished
[23:26:42] [SPG] seed: 74079720
[23:26:42] [SPG] Designing protein sequence 6 of 30


--- Opening Log file [November 12 09:25:30]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[09:25:30] - Ask before connecting: Yes
[09:25:30] - Use IE connection settings: Yes
[09:25:30] - User name: boheemee (Team 33258)
[09:25:30] - User ID = 4FE44F3853D9CFCF
[09:25:30] - Machine ID: 1
[09:25:30]
[09:25:31] Loaded queue successfully.
[09:25:31] Initialization complete
[09:25:31] + Benchmarking ...
[09:25:37]
[09:25:37] + Processing work unit
[09:25:37] Core required: FahCore_ca.exe
[09:25:37] Core found.
[09:25:37] Working on Unit 01 [November 12 09:25:37]
[09:25:37] + Working ...
[09:25:42] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[09:25:43]
[09:25:43] Proj: work/wudata_01
[09:25:43] Finding work files
[09:25:43] sizeof(CORE_PACKET_HDR) = 512
[09:25:43] Checking frame files
[09:25:45] Restarting from checkpointed files.
[09:25:45]
[09:25:45] Protein: Des2/pdb1ch4.33.spa
[09:25:45] - Frames Completed: 100, Remaining: 500
[09:25:45] - Dynamic steps required: 100000
[09:25:45]
[09:25:47] Printed current.prm
[09:25:47] Writing local files:
[09:25:47] - Writing "work/wudata_01.key": (overwrite)successful.
[09:25:47] - Writing "work/wudata_01.xyz": (overwrite)successful.
[09:25:48] - Writing "work/wudata_01.prm": (overwrite)successful.
[09:25:49] Starting design engine
[09:25:49] [SPG] project name: work/wudata_01.
[09:25:49] [SPG] 1 5
[09:25:49] [SPG] Initializing protein design engine
[09:25:49] [SPG] seed = 12346620
[09:25:49] [SPG] Initialization complete
[09:25:49] [SPG] Writing current.pdb, chainlength = 146
[09:25:49] [SPG] Writing current.xyz
[09:25:49] [SPG] Preprocessing . . .
[09:25:49] [SPG] 146 positions in protein
[09:31:49] [SPG] Preprocessing complete
[09:31:49] Iterations: 100 of 600
[09:31:50] Finished
[09:31:51] [SPG] Native chi angles stored
[09:31:54] [SPG] Rotamers read
[09:31:54] [SPG] Starting genetic algorithm
[09:37:19] [SPG] seed: 74079720
[09:37:19] [SPG] Designing protein sequence 6 of 30
[09:53:51] [SPG] 10.0
[10:08:09] [SPG] 20.0
[10:21:54] [SPG] 30.0
[10:34:52] [SPG] 40.0
[10:49:03] [SPG] 50.0
[11:01:36] [SPG] 60.0
[11:15:21] [SPG] 70.0
[11:28:11] [SPG] 80.0
[11:41:07] [SPG] 90.0
[11:53:59] [SPG] 100.0
[11:53:59] [SPG] Writing current.xyz
[11:53:59] [SPG] Sequence 6 completed:
[11:53:59] SNMDTEYNRKIKAFLQKINKJTMGAKALAMLVKVKKQYQSYMKQAGSMHQ . . .
[11:54:01] Iterations: 120 of 600
[11:54:02] Finished
[11:54:04] [SPG] seed: 86426340
[11:54:04] [SPG] Designing protein sequence 7 of 30
[12:10:19] [SPG] 10.0
[12:25:20] [SPG] 20.0
[12:39:52] [SPG] 30.0
[12:53:44] [SPG] 40.0
[13:07:04] [SPG] 50.0
[13:20:02] [SPG] 60.0
[13:32:29] [SPG] 70.0
[13:44:47] [SPG] 80.0
[13:57:03] [SPG] 90.0
[14:09:37] [SPG] 100.0
[14:09:37] [SPG] Writing current.xyz
[14:09:38] [SPG] Sequence 7 completed:
[14:09:38] ASGTNNILQLVKQLLKTLQRKPLGKKMMALMLVNYQQFLDYLRNYGEARN . . .
[14:09:39] Iterations: 140 of 600
[14:09:40] Finished
[14:09:42] [SPG] seed: 98772960
[14:09:42] [SPG] Designing protein sequence 8 of 30
[14:25:40] [SPG] 10.0
[14:39:53] [SPG] 20.0
[14:53:56] [SPG] 30.0
[15:08:02] [SPG] 40.0
[15:21:46] [SPG] 50.0
[15:25:33] + Working...
[15:35:09] [SPG] 60.0
[15:48:16] [SPG] 70.0
[16:01:07] [SPG] 80.0
[16:13:38] [SPG] 90.0
[16:26:01] [SPG] 100.0
[16:26:01] [SPG] Writing current.xyz
[16:26:02] [SPG] Sequence 8 completed:
[16:26:02] LSITNKKYELLKEFLEKLKVEQLGKYALAKMMTQASRSQEYMQSKGTIEH . . .
[16:26:03] Iterations: 160 of 600
[16:26:04] Finished
[16:26:06] [SPG] seed: 111119580
[16:26:06] [SPG] Designing protein sequence 9 of 30
[16:40:56] [SPG] 10.0
[16:55:11] [SPG] 20.0
[17:09:08] [SPG] 30.0
[17:23:08] [SPG] 40.0
[17:36:51] [SPG] 50.0
[17:50:05] [SPG] 60.0
[18:03:05] [SPG] 70.0
[18:15:53] [SPG] 80.0
[18:28:53] [SPG] 90.0
[18:41:37] [SPG] 100.0
[18:41:37] [SPG] Writing current.xyz
[18:41:37] [SPG] Sequence 9 completed:
[18:41:37] AQLESRELELLERYMNAIESEPMGMKVIAMIIARKRKAQNYYKELGTMAD . . .
[18:41:39] Iterations: 180 of 600
[18:41:40] Finished
[18:41:42] [SPG] seed: 123466200
[18:41:42] [SPG] Designing protein sequence 10 of 30
[18:56:46] [SPG] 10.0
[19:10:47] [SPG] 20.0
[19:24:18] [SPG] 30.0


--- Opening Log file [November 12 19:37:28]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[19:37:29] - Ask before connecting: Yes
[19:37:29] - Use IE connection settings: Yes
[19:37:29] - User name: boheemee (Team 33258)
[19:37:29] - User ID = 4FE44F3853D9CFCF
[19:37:29] - Machine ID: 1
[19:37:29]
[19:37:29] Loaded queue successfully.
[19:37:29] Initialization complete
[19:37:29] + Benchmarking ...
[19:37:35]
[19:37:35] + Processing work unit
[19:37:35] Core required: FahCore_ca.exe
[19:37:35] Core found.
[19:37:35] Working on Unit 01 [November 12 19:37:35]
[19:37:35] + Working ...
[19:37:41] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[19:37:41]
[19:37:41] Proj: work/wudata_01
[19:37:41] Finding work files
[19:37:41] sizeof(CORE_PACKET_HDR) = 512
[19:37:41] Checking frame files
[19:37:44] Restarting from checkpointed files.
[19:37:44]
[19:37:44] Protein: Des2/pdb1ch4.33.spa
[19:37:44] - Frames Completed: 180, Remaining: 420
[19:37:44] - Dynamic steps required: 84000
[19:37:44]
[19:37:46] Printed current.prm
[19:37:46] Writing local files:
[19:37:46] - Writing "work/wudata_01.key": (overwrite)successful.
[19:37:46] - Writing "work/wudata_01.xyz": (overwrite)successful.
[19:37:47] - Writing "work/wudata_01.prm": (overwrite)successful.
[19:37:47] Starting design engine
[19:37:47] [SPG] project name: work/wudata_01.
[19:37:47] [SPG] 1 9
[19:37:47] [SPG] Initializing protein design engine
[19:37:47] [SPG] seed = 12346620
[19:37:47] [SPG] Initialization complete
[19:37:47] [SPG] Writing current.pdb, chainlength = 146
[19:37:47] [SPG] Writing current.xyz
[19:37:48] [SPG] Preprocessing . . .
[19:37:48] [SPG] 146 positions in protein
[19:44:42] [SPG] Preprocessing complete
[19:44:42] Iterations: 180 of 600
[19:44:43] Finished
[19:44:44] [SPG] Native chi angles stored
[19:44:47] [SPG] Rotamers read
[19:44:47] [SPG] Starting genetic algorithm
[19:50:15] [SPG] seed: 123466200
[19:50:15] [SPG] Designing protein sequence 10 of 30
[20:06:34] [SPG] 10.0
[20:20:20] [SPG] 20.0
[20:33:21] [SPG] 30.0
[20:46:30] [SPG] 40.0
[20:58:24] [SPG] 50.0
[21:04:08] [SPG] 60.0
[21:09:26] [SPG] 70.0
[21:14:32] [SPG] 80.0
[21:19:37] [SPG] 90.0
[21:24:44] [SPG] 100.0
[21:24:44] [SPG] Writing current.xyz
[21:24:44] [SPG] Sequence 10 completed:
[21:24:44] AAAAAAAAAAAAAFAAAAAAKAAGAAAAAAAAAAAAAAAAAAAAAGAAAA . . .
[21:24:45] Iterations: 200 of 600
[21:24:46] Finished
[21:24:48] [SPG] seed: 135812820
[21:24:48] [SPG] Designing protein sequence 11 of 30
[21:39:44] [SPG] 10.0
[21:54:34] [SPG] 20.0
[22:09:06] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome D:\Program Files\MyFolding.html D:\Program Files\MyFolding.html
[22:09:13] [SPG] 30.0
[22:23:45] [SPG] 40.0
[22:38:10] [SPG] 50.0
[22:52:03] [SPG] 60.0
[23:05:23] [SPG] 70.0


Top
 Profile  
Reply with quote  
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 27 posts ]  Go to page Previous  1, 2, 3  Next

All times are UTC - 8 hours


Who is online

Users browsing this forum: No registered users and 3 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group