I'm finally Folding...

This forum is for discussions about the Motherboards.org Folding team. What is folding? Venture on in for a look.

Moderator: The Mod Squad

Postby Tulatin » Wed Nov 12, 2003 7:19 pm

do you have the client set for FAH or GAH?
Tulatin
Enlightened Master
Enlightened Master
 
Posts: 14664
Joined: Wed Dec 11, 2002 2:29 pm
Location: Canada

Postby boheemee » Wed Nov 12, 2003 7:25 pm

client is set to FAH
boheemee
Black Belt
Black Belt
 
Posts: 673
Joined: Sat May 11, 2002 7:28 pm
Location: Tacoma,WA

Postby Tulatin » Wed Nov 12, 2003 7:27 pm

then it's an uncharted one. rather interesting. Not even in the beta units...
Tulatin
Enlightened Master
Enlightened Master
 
Posts: 14664
Joined: Wed Dec 11, 2002 2:29 pm
Location: Canada

Postby boheemee » Wed Nov 12, 2003 7:40 pm

one thing i just thought of, when i installed the software, it began folding right away. i then went into configure, the client was set to no preference (default i assume) i then set it to FAH. think maybe i got a GAH wu?
boheemee
Black Belt
Black Belt
 
Posts: 673
Joined: Sat May 11, 2002 7:28 pm
Location: Tacoma,WA

Postby len444 » Wed Nov 12, 2003 7:42 pm

looks like a genome/ GAH wu. there will be a fahcore_ca.exe present if this is so. how many position protein is stated in fahlog.txt?
len444
Black Belt 3rd Degree
Black Belt 3rd Degree
 
Posts: 3987
Joined: Thu Nov 08, 2001 1:01 am

Postby Tulatin » Wed Nov 12, 2003 7:42 pm

it's rather possible.
Tulatin
Enlightened Master
Enlightened Master
 
Posts: 14664
Joined: Wed Dec 11, 2002 2:29 pm
Location: Canada

Postby boheemee » Wed Nov 12, 2003 7:55 pm

there is a fahcore_ca.exe. 146 positions in protein. sounds like GAH to me.... :( is this a bad thing?
boheemee
Black Belt
Black Belt
 
Posts: 673
Joined: Sat May 11, 2002 7:28 pm
Location: Tacoma,WA

Postby Tulatin » Wed Nov 12, 2003 7:57 pm

give us the full log file please.
Tulatin
Enlightened Master
Enlightened Master
 
Posts: 14664
Joined: Wed Dec 11, 2002 2:29 pm
Location: Canada

Postby evasive » Wed Nov 12, 2003 7:57 pm

fahcore = fah AFAIK, maybe a new clas as said earlier. when in doubt, email stanford.
We hate rut, but we fear change.
********************************
System error, strike any user to continue...
evasive
Mobo-fu Master
Mobo-fu Master
 
Posts: 37389
Joined: Sun May 06, 2001 12:01 am
Location: Netherlands

Postby boheemee » Wed Nov 12, 2003 8:01 pm

Here's the Full log:


--- Opening Log file [November 11 10:34:21]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[10:35:11] - Ask before connecting: No
[10:35:11] - User name: boheemee (Team 33258)
[10:35:11] - User ID not found locally
[10:35:11] + Requesting User ID from server
[10:35:11] - Machine ID: 1
[10:35:11]
[10:35:11] Work directory not found. Creating...
[10:35:11] Could not open work queue, generating new queue...
[10:35:12] Initialization complete
[10:35:12] + Benchmarking ...
[10:35:14] + Attempting to get work packet
[10:35:14] - Connecting to assignment server
[10:35:15] - Successful: assigned to (171.64.122.125).
[10:35:15] + News From Folding@Home: Welcome to Folding@Home
[10:35:15] Loaded queue successfully.
[10:35:15] - Deadline time not received.
[10:35:16] + Closed connections
[10:35:16]
[10:35:16] + Processing work unit
[10:35:16] Core required: FahCore_ca.exe
[10:35:16] Core not found.
[10:35:16] - Core is not present or corrupted.
[10:35:16] - Attempting to download new core...
[10:35:16] + Downloading new core: FahCore_ca.exe
[10:35:16] + 10240 bytes downloaded
[10:35:16] + 20480 bytes downloaded
[10:35:16] + 30720 bytes downloaded
[10:35:17] + 40960 bytes downloaded
[10:35:17] + 51200 bytes downloaded
[10:35:17] + 61440 bytes downloaded
[10:35:17] + 71680 bytes downloaded
[10:35:17] + 81920 bytes downloaded
[10:35:17] + 92160 bytes downloaded
[10:35:17] + 102400 bytes downloaded
[10:35:17] + 112640 bytes downloaded
[10:35:17] + 122880 bytes downloaded
[10:35:17] + 133120 bytes downloaded
[10:35:17] + 143360 bytes downloaded
[10:35:17] + 153600 bytes downloaded
[10:35:17] + 163840 bytes downloaded
[10:35:17] + 174080 bytes downloaded
[10:35:17] + 184320 bytes downloaded
[10:35:17] + 194560 bytes downloaded
[10:35:17] + 204800 bytes downloaded
[10:35:17] + 215040 bytes downloaded
[10:35:17] + 225280 bytes downloaded
[10:35:17] + 235520 bytes downloaded
[10:35:17] + 245760 bytes downloaded
[10:35:17] + 256000 bytes downloaded
[10:35:17] + 266240 bytes downloaded
[10:35:17] + 276480 bytes downloaded
[10:35:17] + 286720 bytes downloaded
[10:35:17] + 296960 bytes downloaded
[10:35:17] + 307200 bytes downloaded
[10:35:17] + 317440 bytes downloaded
[10:35:17] + 327680 bytes downloaded
[10:35:17] + 337920 bytes downloaded
[10:35:18] + 348160 bytes downloaded
[10:35:18] + 358400 bytes downloaded
[10:35:18] + 368640 bytes downloaded
[10:35:18] + 378880 bytes downloaded
[10:35:18] + 389120 bytes downloaded
[10:35:18] + 399360 bytes downloaded
[10:35:18] + 409600 bytes downloaded
[10:35:18] + 419840 bytes downloaded
[10:35:18] + 430080 bytes downloaded
[10:35:18] + 440320 bytes downloaded
[10:35:18] + 450560 bytes downloaded
[10:35:18] + 460800 bytes downloaded
[10:35:18] + 471040 bytes downloaded
[10:35:18] + 480026 bytes downloaded
[10:35:18] Verifying core Core_ca.fah...
[10:35:18] Signature is VALID
[10:35:18] Created: Wednesday April 10, 2002 00:01:22 UTC
[10:35:18] Signed: Monday March 3, 2003 00:18:15 UTC
[10:35:18]
[10:35:18] Trying to unzip core FahCore_ca.exe
[10:35:18] Decompressed FahCore_ca.exe (1466368 bytes) successfully
[10:35:18] + Core successfully engaged
[10:35:23]
[10:35:23] + Processing work unit
[10:35:23] Core required: FahCore_ca.exe
[10:35:23] Core found.
[10:35:23] Working on Unit 01 [November 11 10:35:23]
[10:35:23] + Working ...
[10:35:24] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[10:35:24]
[10:35:24] Proj: work/wudata_01
[10:35:24] Finding work files
[10:35:24] sizeof(CORE_PACKET_HDR) = 512
[10:35:24] Checking frame files
[10:35:24] - Couldn't open work/wudata_01.chk
[10:35:24] Starting from initial work packet
[10:35:24]
[10:35:24] Updating shared core-client information
[10:35:24] - Writing "work/wudata_01.key": (overwrite)successful.
[10:35:24] Key file to update shared file: work/wudata_01.key
[10:35:24] keyfile: 0 146 200 15 2 1 0
[10:35:24] Protein: Des2/pdb1ch4.33.spa
[10:35:24] - Frames Completed: 0, Remaining: 600
[10:35:24] - Dynamic steps required: 120000
[10:35:24]
[10:35:26] Printed current.prm
[10:35:26] Writing local files:
[10:35:26] - Writing "work/wudata_01.key": (overwrite)successful.
[10:35:26] - Writing "work/wudata_01.xyz": (overwrite)successful.
[10:35:26] - Writing "work/wudata_01.prm": (overwrite)successful.
[10:35:27] Starting design engine
[10:35:27] [SPG] project name: work/wudata_01.
[10:35:27] [SPG] 1 0
[10:35:27] [SPG] Initializing protein design engine
[10:35:27] [SPG] seed = 0
[10:35:27] [SPG] Initialization complete
[10:35:27] [SPG] Writing current.pdb, chainlength = 146
[10:35:27] [SPG] Writing current.xyz
[10:35:27] [SPG] Preprocessing . . .
[10:35:27] [SPG] 146 positions in protein


--- Opening Log file [November 11 10:38:48]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[10:38:48] - Ask before connecting: Yes
[10:38:48] - Use IE connection settings: Yes
[10:38:48] - User name: boheemee (Team 33258)
[10:38:48] - User ID = 4FE44F3853D9CFCF
[10:38:48] - Machine ID: 1
[10:38:48]
[10:38:48] Loaded queue successfully.
[10:38:48] Initialization complete
[10:38:48] + Benchmarking ...
[10:38:50]
[10:38:50] + Processing work unit
[10:38:50] Core required: FahCore_ca.exe
[10:38:50] Core found.
[10:38:50] Working on Unit 01 [November 11 10:38:50]
[10:38:50] + Working ...
[10:38:50] + Working...
[10:38:51] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[10:38:51]
[10:38:51] Proj: work/wudata_01
[10:38:51] Finding work files
[10:38:51] sizeof(CORE_PACKET_HDR) = 512
[10:38:51] Checking frame files
[10:38:51] - Couldn't open work/wudata_01.chk
[10:38:51] Starting from initial work packet
[10:38:51]
[10:38:51] Updating shared core-client information
[10:38:51] - Writing "work/wudata_01.key": (overwrite)successful.
[10:38:51] Key file to update shared file: work/wudata_01.key
[10:38:51] keyfile: 0 146 200 15 2 1 0
[10:38:51] Protein: Des2/pdb1ch4.33.spa
[10:38:51] - Frames Completed: 0, Remaining: 600
[10:38:51] - Dynamic steps required: 120000
[10:38:51]
[10:38:53] Printed current.prm
[10:38:53] Writing local files:
[10:38:53] - Writing "work/wudata_01.key": (overwrite)successful.
[10:38:53] - Writing "work/wudata_01.xyz": (overwrite)successful.
[10:38:54] - Writing "work/wudata_01.prm": (overwrite)successful.
[10:38:54] Starting design engine
[10:38:54] [SPG] project name: work/wudata_01.
[10:38:54] [SPG] 1 0
[10:38:54] [SPG] Initializing protein design engine
[10:38:54] [SPG] seed = 0
[10:38:54] [SPG] Initialization complete
[10:38:54] [SPG] Writing current.pdb, chainlength = 146
[10:38:54] [SPG] Writing current.xyz
[10:38:54] [SPG] Preprocessing . . .
[10:38:54] [SPG] 146 positions in protein
[10:41:38] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome D:\Program Files\MyFolding.html D:\Program Files\MyFolding.html
[10:43:02] Printing Queue Information
CURRENT QUEUE:
00 EMPTY
01 *ACTIVE " " (ca) 171.64.122.125:8080 November 11 10:35:16
02 EMPTY
03 EMPTY
04 EMPTY
05 EMPTY
06 EMPTY
07 EMPTY
08 EMPTY
09 EMPTY
[10:45:04] [SPG] Preprocessing complete
[10:45:04] Iterations: 0 of 600
[10:45:05] Finished
[10:45:05] [SPG] Native chi angles stored
[10:45:08] [SPG] Rotamers read
[10:45:08] [SPG] Starting genetic algorithm
[10:48:45] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/teampage?q=33258 http://folding.stanford.edu/cgi-bin/teampage?q=33258
[10:50:47] [SPG] seed: 12346620
[10:50:47] [SPG] Designing protein sequence 1 of 30
[10:56:14] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome D:\Program Files\MyFolding.html D:\Program Files\MyFolding.html
[11:05:50] [SPG] 10.0
[11:19:50] [SPG] 20.0
[11:33:51] [SPG] 30.0
[11:35:52] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/userpage?q=boheemee http://folding.stanford.edu/cgi-bin/userpage?q=boheemee


--- Opening Log file [November 11 11:40:18]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[11:40:19] - Ask before connecting: Yes
[11:40:19] - Use IE connection settings: Yes
[11:40:19] - User name: boheemee (Team 33258)
[11:40:19] - User ID = 4FE44F3853D9CFCF
[11:40:19] - Machine ID: 1
[11:40:19]
[11:40:20] Loaded queue successfully.
[11:40:20] Initialization complete
[11:40:20] + Benchmarking ...
[11:40:25]
[11:40:25] + Processing work unit
[11:40:25] Core required: FahCore_ca.exe
[11:40:25] Core found.
[11:40:26] Working on Unit 01 [November 11 11:40:26]
[11:40:26] + Working ...
[11:40:34] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[11:40:34]
[11:40:34] Proj: work/wudata_01
[11:40:34] Finding work files
[11:40:34] sizeof(CORE_PACKET_HDR) = 512
[11:40:34] Checking frame files
[11:40:36] Restarting from checkpointed files.
[11:40:36]
[11:40:36] Protein: Des2/pdb1ch4.33.spa
[11:40:36] - Frames Completed: 0, Remaining: 600
[11:40:36] - Dynamic steps required: 120000
[11:40:36]
[11:40:38] Printed current.prm
[11:40:38] Writing local files:
[11:40:38] - Writing "work/wudata_01.key": (overwrite)successful.
[11:40:38] - Writing "work/wudata_01.xyz": (overwrite)successful.
[11:40:39] - Writing "work/wudata_01.prm": (overwrite)successful.
[11:40:39] Starting design engine
[11:40:39] [SPG] project name: work/wudata_01.
[11:40:39] [SPG] 1 0
[11:40:39] [SPG] Initializing protein design engine
[11:40:39] [SPG] seed = 12346620
[11:40:39] [SPG] Initialization complete
[11:40:39] [SPG] Writing current.pdb, chainlength = 146
[11:40:39] [SPG] Writing current.xyz
[11:40:40] [SPG] Preprocessing . . .
[11:40:40] [SPG] 146 positions in protein
[11:47:07] [SPG] Preprocessing complete
[11:47:07] Iterations: 0 of 600
[11:47:08] Finished
[11:47:09] [SPG] Native chi angles stored
[11:47:12] [SPG] Rotamers read
[11:47:12] [SPG] Starting genetic algorithm
[11:53:05] [SPG] seed: 12346620
[11:53:05] [SPG] Designing protein sequence 1 of 30
[12:08:50] [SPG] 10.0
[12:24:34] [SPG] 20.0
[12:40:00] [SPG] 30.0
[12:55:01] [SPG] 40.0
[13:09:37] [SPG] 50.0
[13:18:38] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/userpage?q=boheemee http://folding.stanford.edu/cgi-bin/userpage?q=boheemee
[13:24:30] [SPG] 60.0
[13:40:50] [SPG] 70.0
[13:53:27] [SPG] 80.0
[14:05:40] [SPG] 90.0
[14:18:53] [SPG] 100.0
[14:18:53] [SPG] Writing current.xyz
[14:18:54] [SPG] Sequence 1 completed:
[14:18:54] ASMDSRKEEQFEKLISNLSMRDLGKASLALVLSERERMVTMYQSLGNLSD . . .
[14:18:55] Iterations: 20 of 600
[14:18:56] Finished
[14:18:58] [SPG] seed: 24693240
[14:18:58] [SPG] Designing protein sequence 2 of 30
[14:34:05] [SPG] 10.0
[14:48:52] [SPG] 20.0
[15:03:19] [SPG] 30.0
[15:17:10] [SPG] 40.0
[15:30:55] [SPG] 50.0
[15:44:51] [SPG] 60.0
[15:58:44] [SPG] 70.0
[16:12:01] [SPG] 80.0
[16:24:53] [SPG] 90.0
[16:37:23] [SPG] 100.0
[16:37:23] [SPG] Writing current.xyz
[16:37:24] [SPG] Sequence 2 completed:
[16:37:24] SQFKSAQSTLTMEFMAKLKLPQVGKEVLALIITNVETAARYVTAYGQMAE . . .
[16:37:25] Iterations: 40 of 600
[16:37:26] Finished
[16:37:28] [SPG] seed: 37039860
[16:37:28] [SPG] Designing protein sequence 3 of 30
[16:52:33] [SPG] 10.0
[17:06:56] [SPG] 20.0
[17:20:51] [SPG] 30.0
[17:34:32] [SPG] 40.0
[17:40:21] + Working...
[17:48:06] [SPG] 50.0
[18:01:44] [SPG] 60.0
[18:14:58] [SPG] 70.0
[18:28:11] [SPG] 80.0
[18:41:14] [SPG] 90.0
[18:54:10] [SPG] 100.0
[18:54:10] [SPG] Writing current.xyz
[18:54:11] [SPG] Sequence 3 completed:
[18:54:11] SELTEVEKKQVRELLRQLASEPIGLKALAELLIDIEDMQEYYVEWGNLTR . . .
[18:54:12] Iterations: 60 of 600
[18:54:13] Finished
[18:54:15] [SPG] seed: 49386480
[18:54:15] [SPG] Designing protein sequence 4 of 30
[19:09:17] [SPG] 10.0
[19:23:31] [SPG] 20.0
[19:37:31] [SPG] 30.0
[19:51:07] [SPG] 40.0
[20:04:50] [SPG] 50.0
[20:18:20] [SPG] 60.0
[20:31:57] [SPG] 70.0
[20:45:06] [SPG] 80.0
[20:58:16] [SPG] 90.0
[21:11:01] [SPG] 100.0
[21:11:01] [SPG] Writing current.xyz
[21:11:02] [SPG] Sequence 4 completed:
[21:11:02] SSHQERQNRKVEQLKSEAKYDEIGKEALAKLLTTKEEMKQWMTKJGEINQ . . .
[21:11:03] Iterations: 80 of 600
[21:11:04] Finished
[21:11:06] [SPG] seed: 61733100
[21:11:06] [SPG] Designing protein sequence 5 of 30
[21:26:08] [SPG] 10.0
[21:40:38] [SPG] 20.0
[21:55:28] [SPG] 30.0
[22:09:35] [SPG] 40.0
[22:22:38] [SPG] 50.0
[22:36:14] [SPG] 60.0
[22:48:59] [SPG] 70.0
[23:01:52] [SPG] 80.0
[23:14:15] [SPG] 90.0
[23:26:38] [SPG] 100.0
[23:26:38] [SPG] Writing current.xyz
[23:26:38] [SPG] Sequence 5 completed:
[23:26:38] IALDENKKEKIRDMIRSVVTNTIGRKAFALVIRKVPSTMQYYREYGRLRS . . .
[23:26:39] Iterations: 100 of 600
[23:26:40] Finished
[23:26:42] [SPG] seed: 74079720
[23:26:42] [SPG] Designing protein sequence 6 of 30


--- Opening Log file [November 12 09:25:30]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[09:25:30] - Ask before connecting: Yes
[09:25:30] - Use IE connection settings: Yes
[09:25:30] - User name: boheemee (Team 33258)
[09:25:30] - User ID = 4FE44F3853D9CFCF
[09:25:30] - Machine ID: 1
[09:25:30]
[09:25:31] Loaded queue successfully.
[09:25:31] Initialization complete
[09:25:31] + Benchmarking ...
[09:25:37]
[09:25:37] + Processing work unit
[09:25:37] Core required: FahCore_ca.exe
[09:25:37] Core found.
[09:25:37] Working on Unit 01 [November 12 09:25:37]
[09:25:37] + Working ...
[09:25:42] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[09:25:43]
[09:25:43] Proj: work/wudata_01
[09:25:43] Finding work files
[09:25:43] sizeof(CORE_PACKET_HDR) = 512
[09:25:43] Checking frame files
[09:25:45] Restarting from checkpointed files.
[09:25:45]
[09:25:45] Protein: Des2/pdb1ch4.33.spa
[09:25:45] - Frames Completed: 100, Remaining: 500
[09:25:45] - Dynamic steps required: 100000
[09:25:45]
[09:25:47] Printed current.prm
[09:25:47] Writing local files:
[09:25:47] - Writing "work/wudata_01.key": (overwrite)successful.
[09:25:47] - Writing "work/wudata_01.xyz": (overwrite)successful.
[09:25:48] - Writing "work/wudata_01.prm": (overwrite)successful.
[09:25:49] Starting design engine
[09:25:49] [SPG] project name: work/wudata_01.
[09:25:49] [SPG] 1 5
[09:25:49] [SPG] Initializing protein design engine
[09:25:49] [SPG] seed = 12346620
[09:25:49] [SPG] Initialization complete
[09:25:49] [SPG] Writing current.pdb, chainlength = 146
[09:25:49] [SPG] Writing current.xyz
[09:25:49] [SPG] Preprocessing . . .
[09:25:49] [SPG] 146 positions in protein
[09:31:49] [SPG] Preprocessing complete
[09:31:49] Iterations: 100 of 600
[09:31:50] Finished
[09:31:51] [SPG] Native chi angles stored
[09:31:54] [SPG] Rotamers read
[09:31:54] [SPG] Starting genetic algorithm
[09:37:19] [SPG] seed: 74079720
[09:37:19] [SPG] Designing protein sequence 6 of 30
[09:53:51] [SPG] 10.0
[10:08:09] [SPG] 20.0
[10:21:54] [SPG] 30.0
[10:34:52] [SPG] 40.0
[10:49:03] [SPG] 50.0
[11:01:36] [SPG] 60.0
[11:15:21] [SPG] 70.0
[11:28:11] [SPG] 80.0
[11:41:07] [SPG] 90.0
[11:53:59] [SPG] 100.0
[11:53:59] [SPG] Writing current.xyz
[11:53:59] [SPG] Sequence 6 completed:
[11:53:59] SNMDTEYNRKIKAFLQKINKJTMGAKALAMLVKVKKQYQSYMKQAGSMHQ . . .
[11:54:01] Iterations: 120 of 600
[11:54:02] Finished
[11:54:04] [SPG] seed: 86426340
[11:54:04] [SPG] Designing protein sequence 7 of 30
[12:10:19] [SPG] 10.0
[12:25:20] [SPG] 20.0
[12:39:52] [SPG] 30.0
[12:53:44] [SPG] 40.0
[13:07:04] [SPG] 50.0
[13:20:02] [SPG] 60.0
[13:32:29] [SPG] 70.0
[13:44:47] [SPG] 80.0
[13:57:03] [SPG] 90.0
[14:09:37] [SPG] 100.0
[14:09:37] [SPG] Writing current.xyz
[14:09:38] [SPG] Sequence 7 completed:
[14:09:38] ASGTNNILQLVKQLLKTLQRKPLGKKMMALMLVNYQQFLDYLRNYGEARN . . .
[14:09:39] Iterations: 140 of 600
[14:09:40] Finished
[14:09:42] [SPG] seed: 98772960
[14:09:42] [SPG] Designing protein sequence 8 of 30
[14:25:40] [SPG] 10.0
[14:39:53] [SPG] 20.0
[14:53:56] [SPG] 30.0
[15:08:02] [SPG] 40.0
[15:21:46] [SPG] 50.0
[15:25:33] + Working...
[15:35:09] [SPG] 60.0
[15:48:16] [SPG] 70.0
[16:01:07] [SPG] 80.0
[16:13:38] [SPG] 90.0
[16:26:01] [SPG] 100.0
[16:26:01] [SPG] Writing current.xyz
[16:26:02] [SPG] Sequence 8 completed:
[16:26:02] LSITNKKYELLKEFLEKLKVEQLGKYALAKMMTQASRSQEYMQSKGTIEH . . .
[16:26:03] Iterations: 160 of 600
[16:26:04] Finished
[16:26:06] [SPG] seed: 111119580
[16:26:06] [SPG] Designing protein sequence 9 of 30
[16:40:56] [SPG] 10.0
[16:55:11] [SPG] 20.0
[17:09:08] [SPG] 30.0
[17:23:08] [SPG] 40.0
[17:36:51] [SPG] 50.0
[17:50:05] [SPG] 60.0
[18:03:05] [SPG] 70.0
[18:15:53] [SPG] 80.0
[18:28:53] [SPG] 90.0
[18:41:37] [SPG] 100.0
[18:41:37] [SPG] Writing current.xyz
[18:41:37] [SPG] Sequence 9 completed:
[18:41:37] AQLESRELELLERYMNAIESEPMGMKVIAMIIARKRKAQNYYKELGTMAD . . .
[18:41:39] Iterations: 180 of 600
[18:41:40] Finished
[18:41:42] [SPG] seed: 123466200
[18:41:42] [SPG] Designing protein sequence 10 of 30
[18:56:46] [SPG] 10.0
[19:10:47] [SPG] 20.0
[19:24:18] [SPG] 30.0


--- Opening Log file [November 12 19:37:28]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[19:37:29] - Ask before connecting: Yes
[19:37:29] - Use IE connection settings: Yes
[19:37:29] - User name: boheemee (Team 33258)
[19:37:29] - User ID = 4FE44F3853D9CFCF
[19:37:29] - Machine ID: 1
[19:37:29]
[19:37:29] Loaded queue successfully.
[19:37:29] Initialization complete
[19:37:29] + Benchmarking ...
[19:37:35]
[19:37:35] + Processing work unit
[19:37:35] Core required: FahCore_ca.exe
[19:37:35] Core found.
[19:37:35] Working on Unit 01 [November 12 19:37:35]
[19:37:35] + Working ...
[19:37:41] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[19:37:41]
[19:37:41] Proj: work/wudata_01
[19:37:41] Finding work files
[19:37:41] sizeof(CORE_PACKET_HDR) = 512
[19:37:41] Checking frame files
[19:37:44] Restarting from checkpointed files.
[19:37:44]
[19:37:44] Protein: Des2/pdb1ch4.33.spa
[19:37:44] - Frames Completed: 180, Remaining: 420
[19:37:44] - Dynamic steps required: 84000
[19:37:44]
[19:37:46] Printed current.prm
[19:37:46] Writing local files:
[19:37:46] - Writing "work/wudata_01.key": (overwrite)successful.
[19:37:46] - Writing "work/wudata_01.xyz": (overwrite)successful.
[19:37:47] - Writing "work/wudata_01.prm": (overwrite)successful.
[19:37:47] Starting design engine
[19:37:47] [SPG] project name: work/wudata_01.
[19:37:47] [SPG] 1 9
[19:37:47] [SPG] Initializing protein design engine
[19:37:47] [SPG] seed = 12346620
[19:37:47] [SPG] Initialization complete
[19:37:47] [SPG] Writing current.pdb, chainlength = 146
[19:37:47] [SPG] Writing current.xyz
[19:37:48] [SPG] Preprocessing . . .
[19:37:48] [SPG] 146 positions in protein
[19:44:42] [SPG] Preprocessing complete
[19:44:42] Iterations: 180 of 600
[19:44:43] Finished
[19:44:44] [SPG] Native chi angles stored
[19:44:47] [SPG] Rotamers read
[19:44:47] [SPG] Starting genetic algorithm
[19:50:15] [SPG] seed: 123466200
[19:50:15] [SPG] Designing protein sequence 10 of 30
[20:06:34] [SPG] 10.0
[20:20:20] [SPG] 20.0
[20:33:21] [SPG] 30.0
[20:46:30] [SPG] 40.0
[20:58:24] [SPG] 50.0
[21:04:08] [SPG] 60.0
[21:09:26] [SPG] 70.0
[21:14:32] [SPG] 80.0
[21:19:37] [SPG] 90.0
[21:24:44] [SPG] 100.0
[21:24:44] [SPG] Writing current.xyz
[21:24:44] [SPG] Sequence 10 completed:
[21:24:44] AAAAAAAAAAAAAFAAAAAAKAAGAAAAAAAAAAAAAAAAAAAAAGAAAA . . .
[21:24:45] Iterations: 200 of 600
[21:24:46] Finished
[21:24:48] [SPG] seed: 135812820
[21:24:48] [SPG] Designing protein sequence 11 of 30
[21:39:44] [SPG] 10.0
[21:54:34] [SPG] 20.0
[22:09:06] Opening "C:\PROGRA~1\INTERN~1\iexplore.exe" -nohome D:\Program Files\MyFolding.html D:\Program Files\MyFolding.html
[22:09:13] [SPG] 30.0
[22:23:45] [SPG] 40.0
[22:38:10] [SPG] 50.0
[22:52:03] [SPG] 60.0
[23:05:23] [SPG] 70.0
boheemee
Black Belt
Black Belt
 
Posts: 673
Joined: Sat May 11, 2002 7:28 pm
Location: Tacoma,WA

PreviousNext

Return to Motherboards.org Folding Team

Who is online

Users browsing this forum: No registered users and 1 guest

cron